PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta008988
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family HD-ZIP
Protein Properties Length: 279aa    MW: 31542.8 Da    PI: 5.055
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pta#S26642690PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.62.2e-1865119256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+++++ +q++ Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Pta008988  65 RKKRRLSLQQVRSLEKTFEVENKLEPERKLQLAQELGLQPRQVAVWFQNRRARWK 119
                677799************************************************9 PP

2HD-ZIP_I/II125.13.2e-4065156192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  +kkrrls +qv++LE++Fe e+kLeperK +la+eLglqprqvavWFqnrRAR+ktkqlE+dy +Lk +y+ lk++ +++++e+++L++el+
    Pta008988  65 RKKRRLSLQQVRSLEKTFEVENKLEPERKLQLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGQLKLNYECLKSNFDAIKQENQKLTSELN 156
                  69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-2047122IPR009057Homeodomain-like
SuperFamilySSF466899.41E-2155123IPR009057Homeodomain-like
PROSITE profilePS5007118.54461121IPR001356Homeobox domain
SMARTSM003893.9E-1764125IPR001356Homeobox domain
PfamPF000468.8E-1665119IPR001356Homeobox domain
CDDcd000861.49E-1665122No hitNo description
PRINTSPR000316.2E-692101IPR000047Helix-turn-helix motif
PROSITE patternPS00027096119IPR017970Homeobox, conserved site
PRINTSPR000316.2E-6101117IPR000047Helix-turn-helix motif
PfamPF021839.9E-15121161IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
RPGEDLGPHS NPNKDIAIPT RTKMETTGTF KFSIPSPLVG CPGNIHDDDE EEDEEECSGT  60
GQQTRKKRRL SLQQVRSLEK TFEVENKLEP ERKLQLAQEL GLQPRQVAVW FQNRRARWKT  120
KQLERDYGQL KLNYECLKSN FDAIKQENQK LTSELNYLKE KWEETQNLER DNTDLNKANE  180
EKKVFGMGED KAISDTKSLD KTMVCKQDHG GAEIKVTGVA MIFNEKLEGS ESESSAIVNE  240
QADNNNNNNS PHSIDSHIST LSLNCCYVPG PPVASSAIX
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113121RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306291.22e-48hypothetical protein POPTR_0005s07290g
TrEMBLB9H4Q52e-48B9H4Q5_POPTR; Uncharacterized protein
STRINGPOPTR_0005s07290.15e-48(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.16e-43homeobox protein 6